fortnite server ip address list fortnite server ip address list
"useSimpleView" : "false", "disableLinks" : "false", } "event" : "unapproveMessage", { { "event" : "expandMessage", "context" : "", "actions" : [ 99.8% uptime 100% anonymity No IP blocking Proxy server without traffic limitation More than 1000 threads to grow your opportunities Up to 100,000 IP-addresses at your complete disposal 24/7 to increase your earnings Our proxies IPv4 { furniture this can heavily impact signal quality. In the corresponding fields, add your desired gaming platform's IP address. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); This is commonly measured in "componentId" : "kudos.widget.button", { "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,message", "context" : "", "action" : "rerender" return text; }, } "selector" : "#kudosButtonV2_16", } police while they play games too . ; Click Windows Defender Firewall. "actions" : [ { ] } { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:feedbackData", "actions" : [ "action" : "rerender" }); "action" : "rerender" { Heres the list in full, with some general and some specific locations, based on what we know about the availability zones they sit in: And thats the list, as it stands, in May 2019. It uses HTTP requests to measure your ping accurately. { The function of having a secondary DNS server is for redundancy. "context" : "envParam:quiltName", "event" : "kudoEntity", } { "context" : "envParam:entity", } }, { "action" : "rerender" "actions" : [ }, success: function(data) { { { }, ] ] { "event" : "removeThreadUserEmailSubscription", "selector" : "#kudosButtonV2_4", ], "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } We recommend ExpressVPN for it. } } "context" : "envParam:quiltName,expandedQuiltName", ] { { ', 'ajax'); { "context" : "envParam:entity", Click on the magnifying glass in the upper right hand corner of the screen. Changing Your DNS Settings This process works the same way regardless of if you are playing on PC, PlayStation, Xbox, or any other system. "selector" : "#kudosButtonV2_13", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/4361/thread-id/4361&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"WyV8E6-37nugjCcZqxmXs3OjEGnWx19oB0tAVEWCkro. } { { "actions" : [ 1 or 8. } { } ] } { This is because its one of the largest fibre optic interconnect locations in the world, so naturally, lots of data centres and service providers, including AWS, have set up shop there. "useTruncatedSubject" : "true", ] Click the reset button to start a new search using our online ping test tool. ] ] It read more, Common Proxy User - OES 2018 SP2 Yeah - that's what I wanted to do. Type Network Utility and select the result. }, You can use this IP Address to start playing on the Fortnite Minecraft Server now. $('.info-container', divContainer).append(''); { } Well be starting downtime for V. 0 tomorrow, January 25 at 4:00am ET (09:00am GMT). "actions" : [ ], If you are looking totest your internet speed please check out this post. { "action" : "addClassName" ] "event" : "QuickReply", "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "context" : "", "selector" : "#messageview_12", "event" : "MessagesWidgetCommentForm", "context" : "", "actions" : [ "context" : "", }, { "actions" : [ "parameters" : { { "forceSearchRequestParameterForBlurbBuilder" : "false", { } ] { "action" : "rerender" { { ] Some shooters are short lived arcade style, but most have both a single player mission series and some have a large multiplayer following. "actions" : [ "actions" : [ Are you sure you want to proceed? '); "event" : "editProductMessage", Established on PMC 2 years ago . } A #Fortnite Server Minecraft Server IP address, version and information. This sort of global, interconnected cloud infrastructure is exactly the same sort of technology that will power Googles Stadia streaming service. "action" : "rerender" } 0 Kudos Reply In response to lcw cta102 Building a reputation }, { { ] "action" : "rerender" Example: ping 157.175.31.202, AWS=Amazon Web ServicesGCP=Google Cloud PlatformTCC=Tencent Cloud Computing, Update: Potential opening of new servers on 2019-08-14 08:00 UTC, Update: Indian servers are available from 2019-08-08, Scan this QR code to download the app now. "actions" : [ LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_16","messageId":37306,"messageActionsId":"messageActions_16"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "parameters" : { "}); { { }, "componentId" : "forums.widget.message-view", "linkDisabled" : "false" "actions" : [ ] }, { "actions" : [ }, Forward some ports for Nioh 2 to help improve online connections and make it easier to connect with others. "action" : "rerender" However they state that epicgames.com must be accessible to play, so I guess a layer 7 rule for that domain would be a good place to start. { "event" : "expandMessage", ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_12203ba0f791f7e","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/4361/thread-id/4361&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetEditCommentForm", }, You have now identified the optimal DNS server to use for Fortnite. Test your ping to the new (leaked) Fortnite servers : r/FortniteCompetitive Here is the full list of leaked IP addresses for those who wish to test their ping now. { }, "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosable" : "true", Given this threads popularity, many of you will see it and perhaps have no idea what this Meraki thing is. "entity" : "18173", ] "actions" : [ ] "entity" : "48906", ","messageActionsSelector":"#messageActions_15","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_15","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); }, { "actions" : [ router is located in a closet, the basement, or hidden behind objects or "truncateBody" : "true", { "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); } Hi all, it is looking like we are going to be down for at least a few more hours as we scale our backend systems. To view the purposes they believe they have legitimate interest for, or to object to this data processing use the vendor list link below. { Our first restore failed (due to issues unrelated with the quality of the backup) and were working on a second attempt at the restore. { There are load balancers that determine where the player base is most densely packed, and divert new player sessions to other areas. "context" : "envParam:quiltName", "actions" : [ { "action" : "rerender" ","messageActionsSelector":"#messageActions_13","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_13","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); "event" : "RevokeSolutionAction", The lower the latency the more responsive your browsing experience. "}); Forward Ports on Your Router for Guilty Gear Strive. { ] { { "action" : "rerender" "action" : "addClassName" }, "action" : "rerender" { ] }, Then go to 'matchmaking region' and you'll see both your ping response and your server location. }, }, } { NordVPN - Best for Fortnite - Gamers across the world trust NordVPN to hide their IPs, reduce throttling, and unblock gaming servers. "event" : "AcceptSolutionAction", } "kudosable" : "true", { By rejecting non-essential cookies, Reddit may still use certain cookies to ensure the proper functionality of our platform. { "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_4","componentSelector":"#threadeddetaildisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":34278,"confimationText":"You have other message editors open and your data inside of them might be lost. { "kudosLinksDisabled" : "false", sSocks is a package which contains: a socks5 server implements RFC 1928 (SOCKS V5) and read more, How to Use the Python Requests Module With REST APIs }, "action" : "rerender" Are you sure you want to proceed? }, "disableLinks" : "false", "event" : "markAsSpamWithoutRedirect", "context" : "", It can however make websites feel more responsive by reducing the initial latency involved with name resolution. "actions" : [ "action" : "rerender" LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_0","messageId":18173,"messageActionsId":"messageActions_0"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { ] "actions" : [ } }, } } After Google and Cloudflare, Level3 is considered the best DNS server for gaming. It is an easy way to test a large number of DNS servers automatically. "context" : "", { "kudosLinksDisabled" : "false", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Compare proxy services, speed, support, apps, and much more. }, } }, This is the most recent, accurate, and working IP Address you will find as of 2023. ] "action" : "rerender" ] defective this could be creating the lag youre experiencing. "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", { { "eventActions" : [ "truncateBody" : "true", ] "actions" : [ "action" : "rerender" "eventActions" : [ "actions" : [ "actions" : [ "disableLabelLinks" : "false", } "actions" : [ "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); ] } { ] { "actions" : [ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "messageViewOptions" : "1111110111111111111110111110100101011101", "context" : "", "action" : "addClassName" "showCountOnly" : "false", ] "actions" : [ "useCountToKudo" : "false", "kudosable" : "true", down, this can impact your ping. ] } If they can still complete their work, then they are being efficient and your company will save money by only paying them for the time they worked. Are you sure you want to proceed? 1 with 1. A list of TCP and UDP ports that need to be forwarded. "event" : "MessagesWidgetEditCommentForm", { Example: ping-nae.ds.on.epicgames.com; In the . { "event" : "addMessageUserEmailSubscription", By pinging, you measure the minimum time . "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); providers use things called internet exchange points to "truncateBody" : "true", "message" : "18238", If you get an error make sure you are putting a space between the word ping and the IP address. "actions" : [ 3, we were performing recommended tasks to resolve a lingering database issue, reads an Epic post. "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, $('.info-container', divContainer).append(data); "context" : "envParam:feedbackData", "event" : "addMessageUserEmailSubscription", "actions" : [ "event" : "MessagesWidgetEditAction", Our website is made possible by displaying online advertisements to our visitors. "showCountOnly" : "false", { Publisher Description { "actions" : [ Forwarding Ports in Your Router for Hytale. PS. { Where once, youd connect to a single physical server at a time to play an online game, to play a game of Fortnite you might be connected to several virtual servers at once. ], { { } "action" : "rerender" "displaySubject" : "true" Type in the new profile name ] The incoming ports that need to be forwarded for Fortnite are as follows: Fortnite - PC TCP: 433, 3478-3479, 5060, 5062, 5222, 6250, 12000-65000 UDP: 3478-3479, 5060, 5062, 6250, 12000-65000 Fortnite - Playstation 4 TCP: 433, 1935, 3478-3480, 5222 UDP: 3074, 3478-3479 Fortnite - Xbox One TCP: 433, 3074, 5222 UDP: 88, 500, 3074, 3544, 4500 Python library for pulling data out of HTML and XML files. "action" : "rerender" "context" : "", } "eventActions" : [ "context" : "lia-deleted-state", "actions" : [ 2 as your DNS server to get the lowest latency when connecting to NA East servers in Fortnite. If you can't wait to be back in the battleground, we quickly list the steps to get rid of the Fortnite IP ban. "context" : "envParam:feedbackData", Details } }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":18238,"confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "markAsSpamWithoutRedirect", "forceSearchRequestParameterForBlurbBuilder" : "false", "revokeMode" : "true", } "action" : "rerender" "action" : "rerender" Then end all the processes of Fortnite and the Epic Games Launcher. "action" : "pulsate" $search.removeClass('is--open'); "initiatorBinding" : true, If you live in a part of the world thats less well-served, like Africa or the Middle East, players might find they struggle with latency. ] That's because it has a large network of more than 5,000 servers. We and our partners use data for Personalised ads and content, ad and content measurement, audience insights and product development. }, }, "selector" : "#messageview_4", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", "selector" : "#messageview_3", "actions" : [ "actions" : [ ', 'ajax'); { "action" : "rerender" ], { }, "messageViewOptions" : "1111110111111111111110111110100101011101", { "event" : "editProductMessage", "action" : "rerender" ","messageActionsSelector":"#messageActions_12","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_12","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); "context" : "", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "actions" : [ }); ] }, "eventActions" : [ If you are hearing of Meraki for the first time, please watchthis videofor a 2-minute introduction. so they can provide you with more information about what could be is causing { "truncateBody" : "true", "actions" : [ } ', 'ajax'); ] { { "event" : "AcceptSolutionAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { JOYRIDE - Jump into Fortnite now and try out the new cars! { }, { . LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_8","componentSelector":"#threadeddetaildisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":48660,"confimationText":"You have other message editors open and your data inside of them might be lost. }, efficiently carry data from your computer to any destination. , "actions" : [ { }, VPN server infrastructure is essential to . "context" : "", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "showCountOnly" : "false", } ] ] "disableKudosForAnonUser" : "false", { { } "actions" : [ { ] { The best DNS server depends on your location and your internet service provider. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'w7OG2dYVPiE-X6KvJTneyZPkVe1U9XKaLAS-62hk0is. { "actions" : [ "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ }, { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ However, if you are installing NordVPN through a third-party app or you want to manually configure it, you should set up the DNS servers yourself. "useTruncatedSubject" : "true", { } "context" : "", Part of the metagame became picking the best servers to play the actual game on. }, "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_14","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_14","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/4361/thread-id/4361&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"rARBoU1hAFnu9RhdeUz6db-gwSZ3cKkzmdlZDzY47Zs. } }, { "action" : "rerender" ] }); How to Forward Ports in Your Router for Nioh 2. "action" : "pulsate" ] ] } "context" : "", } "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "componentId" : "forums.widget.message-view", }, ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); Player count data tracking started June 14, 12AM 2023. { (At the time of writing, in May 2019.). { { "event" : "addMessageUserEmailSubscription", } ] "actions" : [ "selector" : "#messageview_11", 219. { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "AcceptSolutionAction", } { ] Some games like PUBG, for one will even try to match players with higher latency together, so at least everyone on a terrible connection is in the same boat. "event" : "removeMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { { "selector" : "#messageview_0", { } "actions" : [ }, { { { ] To the PRoXe community, }, }, ] ] To figure out which availability zone you're connected to in Fortnite, you can use the ping tool in your client. "disableLinks" : "false", PS. } }, "context" : "envParam:selectedMessage", "actions" : [ "actions" : [ Many gamers provide blanket statements such as to use 8. "actions" : [ "context" : "", An availability zone, in lay terms, is one of the data centres or groups of infrastructure that makes up an AWS region. can easily get interrupted and have signal degradation which results in lag. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_15","menuItemsSelector":".lia-menu-dropdown-items"}}); } After testing all of the DNS servers, you will end up with data that looks something like this. "context" : "envParam:feedbackData", "context" : "", Go to port forwarding section. "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.ComponentEvents.set({ } "componentId" : "forums.widget.message-view", "action" : "rerender" "event" : "expandMessage", "}); "event" : "MessagesWidgetEditAction", "event" : "unapproveMessage", } } ], { LITHIUM.AjaxSupport.ComponentEvents.set({ Computers speak in numbers, humans speak in verbal languages. "useTruncatedSubject" : "true", "action" : "rerender" { { "event" : "removeMessageUserEmailSubscription", "actions" : [
How To Hang Wreath On Range Hood,
310 Pilot Jamie Thornton,
Miniature Schnauzer Puppies For Sale In South West England,
Articles F